DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32820 and RGD1565057

DIOPT Version :9

Sequence 1:NP_728441.1 Gene:CG32820 / 318228 FlyBaseID:FBgn0052820 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_038957327.1 Gene:RGD1565057 / 309300 RGDID:1565057 Length:372 Species:Rattus norvegicus


Alignment Length:348 Identity:99/348 - (28%)
Similarity:173/348 - (49%) Gaps:37/348 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GAPPCMEPVMGPSIPPRVGAAYETPTKHP-----WRPAMAYELIQVKHMPEQPVTNQLTKQCFLP 174
            |.||..:       .|.|...|..|...|     |||.:.|::...:..|:          |   
  Rat    23 GLPPAGQ-------DPMVQECYHQPFHLPRCRSAWRPRVFYKVAPSQTCPD----------C--- 67

  Fly   175 KGMKTDGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVR 239
            .|.:......|:|            |:....|||..||..:|....|.:..:|..:.||.:|::|
  Rat    68 AGDRRPPTTLPSL------------RSPFSNRYTQREWDRSNDLLISVAEASRLRASRMTDDSLR 120

  Fly   240 LMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIP 304
            ::.:.|:.....|....|.||:|::|:.||::.|..|.:.|:||.:.:..|:|:...|..:.:.|
  Rat   121 IIHDKDQLIRQMQEGTSRNLGQRLSDIRFWKSGLCHERDMLMAESNSLKILKRRLECAADEADSP 185

  Fly   305 LHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLED 369
            |.:|.:||::...|.|.:.|:|.:.|.|:.|.:.||..:|::..|.::|..|..:.|.|||.||.
  Rat   186 LQMALDCLYNPGERLGIDLVYDNLGKNLIREADLLRYCQDQMRKLAKRIDFQIQNNRDAQHALER 250

  Fly   370 DVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQL 434
            |:..|..:..||..|..|.|....|.::.|:|||:.::|..::||:.|:.::|.:|..|||.:||
  Rat   251 DIEDKSCAQSIDERCLNLKNTPDSINFFRGMEKFEETISDPDTWAKFSNNNIRHAQNMRAKSAQL 315

  Fly   435 RSDAQSVVNSVATTVWDFWSNTN 457
            |.:|:.:..:::..:|..::|.|
  Rat   316 REEAEHLFETLSDQMWRQFNNIN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32820NP_728441.1 Tektin 212..591 CDD:281184 77/246 (31%)
RGD1565057XP_038957327.1 Tektin 93..>338 CDD:397319 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.