DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32820 and TEKT5

DIOPT Version :9

Sequence 1:NP_728441.1 Gene:CG32820 / 318228 FlyBaseID:FBgn0052820 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_653275.1 Gene:TEKT5 / 146279 HGNCID:26554 Length:485 Species:Homo sapiens


Alignment Length:490 Identity:172/490 - (35%)
Similarity:283/490 - (57%) Gaps:35/490 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 MESYPWSQAGA-PPCMEPVMGPSIPPRVGAAYETPTKHPWRPAMAYELIQVKHMPEQPVTNQLTK 169
            :.|.|..||.. ..|.:|...|      |..|    .:.|||::.|::..|:..|::. |:.|..
Human    21 LTSLPAVQAPVIQECYQPYYLP------GYRY----LNSWRPSLFYKIANVQTCPDES-TSTLRP 74

  Fly   170 QCFLPKGMKTDGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMR 234
            ...||                       ..|:||::||:.::|..:|..:...:..:|..:.|:.
Human    75 PTILP-----------------------TLRSALFSRYSPHDWDQSNQLQVRGAEASRLWASRLT 116

  Fly   235 NDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALL 299
            :|::||:::.|:.....|....|.||:|::|:.||::||:.||::|:.|..::..::|:...|..
Human   117 DDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGFWKSELSYELDRLLTENQNLETVKRRLECAAN 181

  Fly   300 DLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQ 364
            ::..||.:|.|||:|||.|.|.:.|||.|||.|:.|::.|:..::::..|.::|..|..|.|.||
Human   182 EVNCPLQVALECLYHREKRIGIDLVHDNVEKNLIREVDLLKCCQEQMRKLAQRIDIQMRDNRDAQ 246

  Fly   365 HLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERA 429
            |:||.|:..|.|:..||..|..|.|.|..|:::.|:||.|.::|..|:||:.|:::::.||..||
Human   247 HVLERDLEDKSSAQCIDEKCFNLRNTSDCISFFHGMEKIDGTISVPETWAKFSNDNIKHSQNMRA 311

  Fly   430 KLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFL 494
            ...|||.:|:.:..:::..:|..:::||.||:.|..|:.:.||::|..|.|..||:|..|..:.|
Human   312 NSIQLREEAEHLFETLSDQMWRQFTDTNLAFNARISEVTDVKNKLQTQLAKTLQEIFQAENTIML 376

  Fly   495 LQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQ 559
            |:::|..|.|||||||||||.|:.|..:|||:|..|.:||.||..|...::||..:|.|.:.|.|
Human   377 LERSIMAKEGPLKVAQTRLECRTRRPNMELCRDIPQLKLVNEVFTIDDTLQTLKLRLRETQDTLQ 441

  Fly   560 GLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFP 594
            .|:.|:|.||.:|..|.|.|.||:||||.:|::||
Human   442 LLVMTKCRLEHELAIKANTLCIDKEKCMGMRKTFP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32820NP_728441.1 Tektin 212..591 CDD:281184 145/378 (38%)
TEKT5NP_653275.1 Tektin 94..473 CDD:308655 145/378 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158897
Domainoid 1 1.000 329 1.000 Domainoid score I1158
eggNOG 1 0.900 - - E1_KOG2685
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 342 1.000 Inparanoid score I2349
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59762
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000711
OrthoInspector 1 1.000 - - otm41082
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3619
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.