DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32819 and TEKT4

DIOPT Version :9

Sequence 1:NP_728444.1 Gene:CG32819 / 318227 FlyBaseID:FBgn0052819 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_011508972.1 Gene:TEKT4 / 150483 HGNCID:31012 Length:476 Species:Homo sapiens


Alignment Length:432 Identity:132/432 - (30%)
Similarity:217/432 - (50%) Gaps:43/432 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 TRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFW 269
            ::|...||:.|...:|.::..:|:.|||.|:::.:|..||...|...|:|:.|.:|||:.|...|
Human    37 SKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSW 101

  Fly   270 RNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLV 334
            ::||..|:|.|.||.:.:...:::..:||...|:|..|..:.|..||.|:....|.|.||..||.
Human   102 KSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLK 166

  Fly   335 EINNLRNSRDRL-GGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYG 398
            |...:||.::.| ..:.:.:|:..|: |..:...|.|.|.|..:..||..|.:.::.|..:..:.
Human   167 EAELIRNIQELLKRTIMQAVSQIRLN-REHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHP 230

  Fly   399 GIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRR 463
            ....|..|.||.|:.|:.:.:::.|:|.||...:.||.....::...:..:.......|.||.||
Human   231 YSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRR 295

  Fly   464 SQEMAEAKNRVQLHLQK-----------------------------------------VQQELFD 487
            .:|:.:|:.::..||.|                                         ..:|:.|
Human   296 CEELEDARYKLHHHLHKGHWSGLPSGHSPKTWVGPAWSRRSIYPGMGAQAQGELSCLQTLREITD 360

  Fly   488 MEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLM 552
            .|.::..|::||:||..||.||||||..||||..:|||:|.||.||:.||:::..::..|..||:
Human   361 QEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLL 425

  Fly   553 EAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFP 594
            |||.:.:.|.....:||.|:....|:|||||:|||:.|..:|
Human   426 EAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRYP 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32819NP_728444.1 Tektin 212..591 CDD:281184 128/420 (30%)
TEKT4XP_011508972.1 Tektin 44..464 CDD:281184 128/420 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59762
OrthoDB 1 1.010 - - D264325at33208
OrthoFinder 1 1.000 - - FOG0000711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3872
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.