DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32815 and zgc:113278

DIOPT Version :9

Sequence 1:NP_001284763.1 Gene:CG32815 / 318224 FlyBaseID:FBgn0052815 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001014363.1 Gene:zgc:113278 / 541528 ZFINID:ZDB-GENE-050327-66 Length:374 Species:Danio rerio


Alignment Length:60 Identity:16/60 - (26%)
Similarity:30/60 - (50%) Gaps:9/60 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 DPSTYFQWSGYKDEDSV---LLPALLGFALIGVILIITVCLVARNKRTIVSSVRKRNRND 360
            ||..:::: |.||..:|   ||.|::..|||...::..:     |:|..:|..:....|:
Zfish    69 DPVNFYKY-GAKDIATVFFYLLIAIILHALIQEYILDKI-----NRRLHLSKTKHSKFNE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32815NP_001284763.1 SLC3A2_N <53..94 CDD:292647
zgc:113278NP_001014363.1 TRAM1 46..116 CDD:285576 15/52 (29%)
TRAM_LAG1_CLN8 119..317 CDD:281751 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1608
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.