powered by:
Protein Alignment CG32815 and zgc:113278
DIOPT Version :9
Sequence 1: | NP_001284763.1 |
Gene: | CG32815 / 318224 |
FlyBaseID: | FBgn0052815 |
Length: | 382 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001014363.1 |
Gene: | zgc:113278 / 541528 |
ZFINID: | ZDB-GENE-050327-66 |
Length: | 374 |
Species: | Danio rerio |
Alignment Length: | 60 |
Identity: | 16/60 - (26%) |
Similarity: | 30/60 - (50%) |
Gaps: | 9/60 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 304 DPSTYFQWSGYKDEDSV---LLPALLGFALIGVILIITVCLVARNKRTIVSSVRKRNRND 360
||..:::: |.||..:| ||.|::..|||...::..: |:|..:|..:....|:
Zfish 69 DPVNFYKY-GAKDIATVFFYLLIAIILHALIQEYILDKI-----NRRLHLSKTKHSKFNE 122
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1608 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.