DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32815 and TRAM

DIOPT Version :10

Sequence 1:NP_726709.2 Gene:CG32815 / 318224 FlyBaseID:FBgn0052815 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_726710.1 Gene:TRAM / 31042 FlyBaseID:FBgn0040340 Length:368 Species:Drosophila melanogaster


Alignment Length:42 Identity:12/42 - (28%)
Similarity:23/42 - (54%) Gaps:3/42 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 HWAYIDPSTYFQWSGYKDEDS-VLLPALLGFALIGVILIITV 339
            ::.::.|..|||....|:|.. .::.::.||.||  :|..|:
  Fly   181 YYLHMLPELYFQKIKTKEEQQPKIVHSISGFTLI--VLAYTL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32815NP_726709.2 None
TRAMNP_726710.1 TRAM1 52..121 CDD:462460
TLC 124..290 CDD:214789 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.