powered by:
Protein Alignment CG32815 and TRAM
DIOPT Version :9
Sequence 1: | NP_001284763.1 |
Gene: | CG32815 / 318224 |
FlyBaseID: | FBgn0052815 |
Length: | 382 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001245456.1 |
Gene: | TRAM / 31042 |
FlyBaseID: | FBgn0040340 |
Length: | 368 |
Species: | Drosophila melanogaster |
Alignment Length: | 42 |
Identity: | 12/42 - (28%) |
Similarity: | 23/42 - (54%) |
Gaps: | 3/42 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 299 HWAYIDPSTYFQWSGYKDEDS-VLLPALLGFALIGVILIITV 339
::.::.|..|||....|:|.. .::.::.||.|| :|..|:
Fly 181 YYLHMLPELYFQKIKTKEEQQPKIVHSISGFTLI--VLAYTL 220
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32815 | NP_001284763.1 |
SLC3A2_N |
<53..94 |
CDD:292647 |
|
TRAM | NP_001245456.1 |
TRAM1 |
52..121 |
CDD:285576 |
|
TLC |
124..290 |
CDD:214789 |
12/42 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1608 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.