powered by:
Protein Alignment CG32815 and tram1
DIOPT Version :9
Sequence 1: | NP_001284763.1 |
Gene: | CG32815 / 318224 |
FlyBaseID: | FBgn0052815 |
Length: | 382 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_705955.2 |
Gene: | tram1 / 266757 |
ZFINID: | ZDB-GENE-021011-1 |
Length: | 369 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 21/74 - (28%) |
Similarity: | 34/74 - (45%) |
Gaps: | 18/74 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 299 HWAYIDPSTYFQWSGYKDED--------SVLLPALLG-FAL----IGVILIIT---VCLVARNKR 347
:|.:..|..|||.: |.|| |:.|..:.| :|| :|::|::. |.|:....|
Zfish 175 YWLHAIPELYFQKA--KKEDIPRQLVYISLYLVHIAGAYALNLNRLGLVLLVLHYFVELIFHVSR 237
Fly 348 TIVSSVRKR 356
.|..|..:|
Zfish 238 LIYFSNEER 246
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32815 | NP_001284763.1 |
SLC3A2_N |
<53..94 |
CDD:292647 |
|
tram1 | NP_705955.2 |
TRAM1 |
50..115 |
CDD:285576 |
|
TLC |
117..326 |
CDD:214789 |
21/74 (28%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1608 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.