DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Prss36

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:283 Identity:94/283 - (33%)
Similarity:128/283 - (45%) Gaps:35/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHC-VRGSSPEQLD-- 83
            |......:||.|:.|.||.:|:.|||.  :.|.|.||.:|:.|.|||:|||| |...:.|..|  
Mouse    40 GRPEPSSRIVGGSDAHPGTWPWQVSLH--QGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEL 102

  Fly    84 ---LQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQ 145
               |...||......:.:..||.|.:...|...:... |:|||:||....|...|:||.||....
Mouse   103 SVLLGVHSQDGPLEGAHMRSVATILIPDNYSTVELGA-DLALLRLASPAKLGPSVRPVCLPRASH 166

  Fly   146 VTPGNASAVLAGWGLNATGGVVQQH--------LQKVKLQVFSDTECSERHQ-------TY-LHD 194
            :.....:....||      |.||:.        ||:|:|::..:..|...:.       |: |..
Mouse   167 LFAHGTACWATGW------GDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLP 225

  Fly   195 SQICAGLPEGGKGQCSGDSGGPLLLI--GSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVE 257
            ..:|||.|.|.:..|.|||||||:..  |.....||.|:.. .|.|...|||||.|:.|..||.|
Mouse   226 GMLCAGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGF-GCGRRNRPGVFTAVAPYESWIRE 289

  Fly   258 TVNSYSPPSSLWVGQLIVGRSPP 280
            .|.. |.|..::..||...:|.|
Mouse   290 HVMG-SEPGPVFPSQLQKPQSGP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 83/249 (33%)
Tryp_SPc 30..258 CDD:238113 85/251 (34%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 85/251 (34%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.