DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Prss41

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:256 Identity:96/256 - (37%)
Similarity:136/256 - (53%) Gaps:40/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRG-SSPEQLDLQYGSQMLA 92
            :||.|..:..|.:|:..|||..||  |.||.:||:..||||||||.|. ..||:..:|.| |:.:
Mouse    83 RIVGGIESMQGRWPWQASLRLKKS--HRCGGSLLSRRWVLTAAHCFRKYLDPEKWTVQLG-QLTS 144

  Fly    93 RNS-------SQVARVAAIFVHPGYEPEDKY-VNDIALLQLAQSVALSKFVQPVRLPEPRQVTPG 149
            :.|       |...||..|.|:    .|||. .:|:|||:||.||..:|.:|||.:......:..
Mouse   145 KPSYWNRKAYSGRYRVKDIIVN----SEDKLKSHDLALLRLASSVTYNKDIQPVCVQPSTFTSQH 205

  Fly   150 NASAVLAGWGLNATGGVVQQ---------HLQKVKLQVFSDTECSERHQTY-LH----DSQICAG 200
            .....:.||      ||:|:         ||::|::.:.:::.|.|..:.: ||    ....|||
Mouse   206 QPRCWVTGW------GVLQEDLKPLPPPYHLREVQVSILNNSRCQELFEIFSLHHLITKDVFCAG 264

  Fly   201 LPEGGKGQCSGDSGGPLL--LIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETV 259
            ..:|....|||||||||:  :.|...|:|||||.| .|.||..||::|.||.|.:|| ||:
Mouse   265 AEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSWGI-GCGRPNLPGIYTNVSHYYNWI-ETM 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 92/250 (37%)
Tryp_SPc 30..258 CDD:238113 94/252 (37%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 94/251 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.