DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Prss54

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006531428.1 Gene:Prss54 / 70993 MGIID:1918243 Length:429 Species:Mus musculus


Alignment Length:265 Identity:63/265 - (23%)
Similarity:110/265 - (41%) Gaps:53/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLA----------RN 94
            |||:|||: :.|...|.....:|:.:|:|:.|..          ||:..:::|          :.
Mouse    88 EFPWVVSI-QDKQYTHLAFGCILSEFWILSTASA----------LQHRKEVIAVVGISNMDPRKT 141

  Fly    95 SSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPV-----RLPEPRQVTPGNASAV 154
            ..:...|..|..|..:: .....|:||||:...::..:..||.:     :|.:|    |...:..
Mouse   142 DHREYSVNTIIPHENFD-NVSMGNNIALLKTESAMHFNDLVQAICFLGKKLHKP----PALKNCW 201

  Fly   155 LAGWG-LNATGG-VVQQHLQKVKLQVFSDTE-CSERHQTYLHDSQICAGLPEGGKGQCSGDSGGP 216
            :|||. .:|||. :....|:::.::   |.| |..|.    |....||...:.....|.|:.|.|
Mouse   202 VAGWNPTSATGNHMTMSILRRISVK---DIEVCPLRR----HQKTECASHTKEPNNVCLGEPGSP 259

  Fly   217 LLLIGSDTQV----GIVSWSIKPCARPPFPGVF--TEVSAYVDWIVETVNSYSPP-SSLWVGQLI 274
            ::.......:    |::::....|     ||:|  |.|:.|.|||........|. |||.:.:.:
Mouse   260 MMCQAKKLDLWILRGLLAYGGDSC-----PGLFLYTSVADYSDWITAKTRKAGPSLSSLHLWEKL 319

  Fly   275 VGRSP 279
            |...|
Mouse   320 VFELP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 55/238 (23%)
Tryp_SPc 30..258 CDD:238113 57/241 (24%)
Prss54XP_006531428.1 Tryp_SPc 88..299 CDD:238113 55/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.