DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk12

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:232 Identity:80/232 - (34%)
Similarity:114/232 - (49%) Gaps:17/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR 93
            ||.||........|:.|.|...|..|  ||..|::..||||||||     .::..::.|...|.:
Mouse    21 KIYNGVECVKNSQPWQVGLFHGKYLR--CGGVLVDRKWVLTAAHC-----RDKYVVRLGEHSLTK 78

  Fly    94 N--SSQVARVAAIFVHPGYE-PEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVL 155
            .  :.|:........||.|: ....:.:|:.||:|.:.:.|::.|:||.||. ..||.| |...:
Mouse    79 LDWTEQLRHTTFSITHPSYQGAYQNHEHDLRLLRLNRPIHLTRAVRPVALPS-SCVTTG-AMCHV 141

  Fly   156 AGWG-LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLL 219
            :||| .|.........||.:.|...|:..|.......:.::.:||| .|.||..|.|||||||:.
Mouse   142 SGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFPGRVTENMLCAG-GEAGKDACQGDSGGPLVC 205

  Fly   220 IGSDTQVGIVSW-SIKPCARPPFPGVFTEVSAYVDWI 255
            .|  ...|:||| |:.||.:...|||:|:|..|.|||
Mouse   206 GG--VLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 78/230 (34%)
Tryp_SPc 30..258 CDD:238113 79/231 (34%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 78/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.