DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk5

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_081082.1 Gene:Klk5 / 68668 MGIID:1915918 Length:293 Species:Mus musculus


Alignment Length:260 Identity:78/260 - (30%)
Similarity:119/260 - (45%) Gaps:45/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SGED------GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVR------- 75
            ||||      .:||||:.......|:..:|....:..: |||.|::|.|:||||||.:       
Mouse    56 SGEDTRSDSSSRIVNGSDCQKDAQPWQGALLLGPNKLY-CGAVLISPQWLLTAAHCRKPVFRIRL 119

  Fly    76 ---GSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQP 137
               ..||.   .:.|.||.....|        ..||||. ...:.||:.|:::.:.:..|..|:|
Mouse   120 GHHSMSPV---YESGQQMFQGIKS--------IPHPGYS-HPGHSNDLMLIKMNRKIRDSHSVKP 172

  Fly   138 VRLPEPRQVTPGNASAVLAGWGLNATGGVVQQH------LQKVKLQVFSDTECSERHQTYLHDSQ 196
            |.:  ...........:::|||..::     .|      ||.:.:.|.|:..|...:...:..:.
Mouse   173 VEI--ACDCATEGTRCMVSGWGTTSS-----SHNNFPKVLQCLNITVLSEERCKNSYPGQIDKTM 230

  Fly   197 ICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS 261
            .||| .|.|:..|.||||||::..|.  ..|:|||...|||:...|||:|.:..:|.||.:|:||
Mouse   231 FCAG-DEEGRDSCQGDSGGPVVCNGK--LQGLVSWGDFPCAQRNRPGVYTNLCEFVKWIKDTMNS 292

  Fly   262  261
            Mouse   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 69/241 (29%)
Tryp_SPc 30..258 CDD:238113 71/243 (29%)
Klk5NP_081082.1 Tryp_SPc 67..286 CDD:214473 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.