DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG17242

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:217 Identity:55/217 - (25%)
Similarity:97/217 - (44%) Gaps:29/217 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLARNSS------QVARVAAIFVHPGYEP 112
            :|.||..:.:...:||.|.|||.:..|.:.::.||..  .|:.      :..|:..:.:.|    
  Fly    38 KHHCGGVIYSEDIILTIAECVRKARLEFISVRVGSAQ--ENAGGTVLKVEKMRLQVLGLRP---- 96

  Fly   113 EDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWG----LNATGGVVQQHLQK 173
                 :|:|:|||...:.|...::.:.|.....|...|||  ::|||    :|.:..|:.:...|
  Fly    97 -----SDVAILQLRSPLYLDGGIRAIPLATIPLVPGTNAS--VSGWGQLSAMNPSSEVLLRVDVK 154

  Fly   174 VKLQVFSDTECSERHQTYLHDSQICAGLPEGG-KGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCA 237
            ::.|:...|..:.:.: .:...:|||. |.|. ...|.|..|||  |:.::...||:||. ..|.
  Fly   155 IQDQLMCATNLALKGR-LMSVGEICAA-PAGEIPYACQGFVGGP--LVANNRLYGILSWQ-SACD 214

  Fly   238 RPPFPGVFTEVSAYVDWIVETV 259
            ......|:..::.:..||..||
  Fly   215 VLNKSSVYANIAMFKVWIESTV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 51/211 (24%)
Tryp_SPc 30..258 CDD:238113 53/214 (25%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 53/214 (25%)
Tryp_SPc 24..232 CDD:214473 51/211 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.