DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG17239

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:233 Identity:72/233 - (30%)
Similarity:110/233 - (47%) Gaps:16/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR 93
            :||.|........|:..|:.|.  ||..|||.:.:...|:|||||:.....|.|.::.||. ...
  Fly    23 RIVGGDLITILSVPWQASILRL--GRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSS-FTF 84

  Fly    94 NSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTP--GNASAVLA 156
            ...||.||:::.:|..|  :..:.||||:::|...:.|...|..:.|.:    ||  ..:.|.::
  Fly    85 FGGQVVRVSSVLLHEEY--DQSWSNDIAVMRLQSKLRLGSAVSVIPLAD----TPPASGSPATVS 143

  Fly   157 GWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIG 221
            |||...........:....:.:....:|...:...:....|||..|  ||..||||||||  |:.
  Fly   144 GWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAP--GKDACSGDSGGP--LVS 204

  Fly   222 SDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETV 259
            .:..|||||:. |.||.|.:|||:..|:....||:..:
  Fly   205 GNKLVGIVSFG-KECAHPEYPGVYANVAELKPWILGAI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 70/227 (31%)
Tryp_SPc 30..258 CDD:238113 72/229 (31%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 70/227 (31%)
Tryp_SPc 24..237 CDD:238113 70/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.