DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:248 Identity:92/248 - (37%)
Similarity:135/248 - (54%) Gaps:23/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLD 83
            |..|.|.:..::|....|....:|:.||::..|  :|.||.::|:|:||||||||.|    :..|
Human   194 LACGKSLKTPRVVGVEEASVDSWPWQVSIQYDK--QHVCGGSILDPHWVLTAAHCFR----KHTD 252

  Fly    84 -----LQYGSQMLAR-NSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLP- 141
                 ::.||..|.. .|..||::..|..:|.| |:|   |||||::|...:..|..|:|:.|| 
Human   253 VFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMY-PKD---NDIALMKLQFPLTFSGTVRPICLPF 313

  Fly   142 EPRQVTPGNASAVLAGWGL-NATGGVVQQHLQKVKLQVFSDTECS--ERHQTYLHDSQICAGLPE 203
            ...::||.....:: |||. ...||.:...|.:..:||...|.|:  :.:|..:.:..:|||:||
Human   314 FDEELTPATPLWII-GWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPE 377

  Fly   204 GGKGQCSGDSGGPLLLIGSDTQ-VGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            ||...|.|||||||:....... ||||||.. .|..|..|||:|:||||::||
Human   378 GGVDTCQGDSGGPLMYQSDQWHVVGIVSWGY-GCGGPSTPGVYTKVSAYLNWI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 87/236 (37%)
Tryp_SPc 30..258 CDD:238113 89/237 (38%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 1/2 (50%)
Tryp_SPc 204..429 CDD:214473 87/236 (37%)
Tryp_SPc 205..432 CDD:238113 89/237 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.