DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk4

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:244 Identity:76/244 - (31%)
Similarity:119/244 - (48%) Gaps:27/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDL- 84
            |.||....:|:.|....|...|:..:| .::.| ..|...|::|.|||:||||::.|....|.| 
Mouse    23 ASASSVSSRIIQGQDCSPHSQPWQAAL-FSEDG-FFCSGVLVHPQWVLSAAHCLQESYIVGLGLH 85

  Fly    85 ------QYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQ--PVRLP 141
                  :.||:||..:.|        ..||.:. :..:.||:.|::|.:||..|..::  ||...
Mouse    86 NLKGSQEPGSRMLEAHLS--------IQHPNFN-DPSFANDLMLIKLNESVIESNTIRSIPVATQ 141

  Fly   142 EPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGK 206
            .|   |||: :.:::||| ....|.:...||.|.|.|.|:..|...:....|.|..|||..:..|
Mouse   142 CP---TPGD-TCLVSGWG-QLKNGKLPSLLQCVNLSVASEETCRLLYDPVYHLSMFCAGGGQDQK 201

  Fly   207 GQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            ..|:||||||  ::.:.:..|:||.....|.:|..|.|:|.:..:.:||
Mouse   202 DSCNGDSGGP--IVCNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 71/234 (30%)
Tryp_SPc 30..258 CDD:238113 73/235 (31%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 73/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.