DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:204 Identity:61/204 - (29%)
Similarity:96/204 - (47%) Gaps:28/204 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 EQLDLQYGSQMLARN--SSQVARVAAIFVHPGYEPEDKYVN--DIALLQLAQSVALSKFVQPVRL 140
            :|:.:..|...|..|  :.|.::...:..||.|   ::..|  ||.|::|:..:.|:::|....|
Zfish     2 DQMMVVAGDYTLGANEGTEQYSKPLMLIPHPLY---NRSTNNADIMLIKLSAPIELNRYVSLAPL 63

  Fly   141 PEPRQVTPGNASAVLAGWGLNA-TGGVVQQHLQKVKLQVFSDTEC--SERHQTYLHDSQICAGLP 202
            |:............::|||..: :||::...|:.|:|.:.|..:|  |......:..:.||||..
Zfish    64 PKQNTGLLAGRMCRVSGWGSTSHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAGSS 128

  Fly   203 EGGKGQ---------------CSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYV 252
            .|||..               |.|||||||:..|  ...|:|||. ..|..|.||||:|.||.:.
Zfish   129 TGGKDACKNSTQYLCHLIVYLCQGDSGGPLVCDG--RVYGLVSWG-NGCGDPRFPGVYTAVSRFR 190

  Fly   253 DWIVETVNS 261
            .||.:|:.|
Zfish   191 RWIDQTIYS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 57/196 (29%)
Tryp_SPc 30..258 CDD:238113 59/199 (30%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 59/199 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.