DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and KLK7

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_005037.1 Gene:KLK7 / 5650 HGNCID:6368 Length:253 Species:Homo sapiens


Alignment Length:264 Identity:90/264 - (34%)
Similarity:135/264 - (51%) Gaps:20/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LARLALFYTATFLL------AGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRH-SCGATLLNP 64
            :||..|......||      ||...:..||::|.....|..|:.|:|   .||.. .||..|:|.
Human     1 MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVAL---LSGNQLHCGGVLVNE 62

  Fly    65 YWVLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSV 129
            .||||||||    ...:..:..||..|....:|..:.:..|.||||..: .:|||:.|::|....
Human    63 RWVLTAAHC----KMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQ-THVNDLMLVKLNSQA 122

  Fly   130 ALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVV-QQHLQKVKLQVFSDTECSERHQTYLH 193
            .||..|:.||||.  :..|...:..::|||...:..|. ...|..|.:::.|..:|::.::..|.
Human   123 RLSSMVKKVRLPS--RCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLE 185

  Fly   194 DSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVET 258
            :|.:|||:|:..|..|:|||||||:..|  |..|:|||...||.:|..|||:|:|..:..||.:|
Human   186 NSMLCAGIPDSKKNACNGDSGGPLVCRG--TLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDT 248

  Fly   259 VNSY 262
            :..:
Human   249 MKKH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 80/227 (35%)
Tryp_SPc 30..258 CDD:238113 81/229 (35%)
KLK7NP_005037.1 Tryp_SPc 29..245 CDD:214473 80/227 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147444
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0U
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.