DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and PRSS3

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:243 Identity:80/243 - (32%)
Similarity:118/243 - (48%) Gaps:20/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQ- 89
            :|.|||.|.|......|:.|||   .||.|.||.:|::..||::||||.:    .::.::.|.. 
Human   106 DDDKIVGGYTCEENSLPYQVSL---NSGSHFCGGSLISEQWVVSAAHCYK----TRIQVRLGEHN 163

  Fly    90 -MLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTP--GNA 151
             .:...:.|....|.|..||.|. .|...|||.|::|:....::..|..:.||    .||  ...
Human   164 IKVLEGNEQFINAAKIIRHPKYN-RDTLDNDIMLIKLSSPAVINARVSTISLP----TTPPAAGT 223

  Fly   152 SAVLAGWGLNAT-GGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGG 215
            ..:::|||...: |......|:.:...|.:..||...:...:.:|..|.|..||||..|..||||
Human   224 ECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGG 288

  Fly   216 PLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYS 263
            |::..|.  ..|:|||. ..||....|||:|:|..|||||.:|:.:.|
Human   289 PVVCNGQ--LQGVVSWG-HGCAWKNRPGVYTKVYNYVDWIKDTIAANS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 75/230 (33%)
Tryp_SPc 30..258 CDD:238113 76/232 (33%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 75/230 (33%)
Tryp_SPc 110..328 CDD:238113 76/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.