DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and PRSS1

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:255 Identity:85/255 - (33%)
Similarity:122/255 - (47%) Gaps:13/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCV 74
            |.|.:.|. .||....:|.|||.|........|:.|||   .||.|.||.:|:|..||::|.||.
Human   230 LILTFVAA-ALAAPFDDDDKIVGGYNCEENSVPYQVSL---NSGYHFCGGSLINEQWVVSAGHCY 290

  Fly    75 RGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVR 139
            :.....:|. ::..::|..| .|....|.|..||.|: .....|||.|::|:....::..|..:.
Human   291 KSRIQVRLG-EHNIEVLEGN-EQFINAAKIIRHPQYD-RKTLNNDIMLIKLSSRAVINARVSTIS 352

  Fly   140 LPEPRQVTPGNASAVLAGWGLNATGGV-VQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPE 203
            ||.....|  ....:::|||..|:.|. ....||.:...|.|..:|...:...:..:..|.|..|
Human   353 LPTAPPAT--GTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLE 415

  Fly   204 GGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYS 263
            |||..|.||||||::..|.  ..|:|||. ..||:...|||:|:|..||.||..|:.:.|
Human   416 GGKDSCQGDSGGPVVCNGQ--LQGVVSWG-DGCAQKNKPGVYTKVYNYVKWIKNTIAANS 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 75/226 (33%)
Tryp_SPc 30..258 CDD:238113 76/228 (33%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 75/226 (33%)
Tryp_SPc 249..467 CDD:238113 76/228 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.