DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and PROC

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:256 Identity:83/256 - (32%)
Similarity:131/256 - (51%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQML 91
            |.::::|.....|:.|:.|.|..:|. :.:|||.|::|.||||||||:..|  ::|.::.|...|
Human   324 DPRLIDGKMTRRGDSPWQVVLLDSKK-KLACGAVLIHPSWVLTAAHCMDES--KKLLVRLGEYDL 385

  Fly    92 AR--NSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPE----PRQVTPGN 150
            .|  .......:..:||||.|. :....||||||.|||...||:.:.|:.||:    .|::....
Human   386 RRWEKWELDLDIKEVFVHPNYS-KSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAG 449

  Fly   151 ASAVLAGWGLNATGGVVQQH-----LQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCS 210
            ...::.|||.:::.....:.     |..:|:.|....||||.....:.::.:|||:....:..|.
Human   450 QETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACE 514

  Fly   211 GDSGGPLL--LIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYSPPSSLW 269
            ||||||::  ..|:...||:|||. :.|......||:|:||.|:|||...:.....|...|
Human   515 GDSGGPMVASFHGTWFLVGLVSWG-EGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSW 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 78/238 (33%)
Tryp_SPc 30..258 CDD:238113 80/240 (33%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114
Tryp_SPc 328..563 CDD:238113 80/239 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.