DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and si:dkey-21e2.16

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001038273.1 Gene:si:dkey-21e2.16 / 556598 ZFINID:ZDB-GENE-050208-698 Length:251 Species:Danio rerio


Alignment Length:229 Identity:79/229 - (34%)
Similarity:118/229 - (51%) Gaps:13/229 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLARN 94
            |.:||.|.|...|::|||:  ..|.|.||.:|:...:|||||||  ....:.:.:..|:..|:.|
Zfish    26 IEDGTEAKPHSRPYMVSLQ--IKGWHICGGSLITEQFVLTAAHC--WEKGDVITVVVGAHDLSGN 86

  Fly    95 SSQVA-RVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGW 158
            .:..: .|.:...||.|: :..|.|||.||:|.:.|.||..|..:.||:..:....:....:|||
Zfish    87 KTYDSFDVTSYIPHPDYK-QSSYKNDILLLKLNKKVTLSNNVGLISLPKEGENVEADTLCSVAGW 150

  Fly   159 GLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQ-ICAGLPEGGKGQCSGDSGGPLLLIGS 222
            |.....|....||::....:.:|.||..|.:.....|: ||.   .|..|.||||||||  |:..
Zfish   151 GRLWVRGPRPGHLREADTVIMTDEECKRRWEIKFKVSKMICV---YGHGGSCSGDSGGP--LVCG 210

  Fly   223 DTQVGIVSWSIK-PCARPPFPGVFTEVSAYVDWI 255
            ||.||:.|::.: .|.....|.|:.::|||:.||
Zfish   211 DTVVGVTSFTDRYLCNSRLRPNVYAKISAYIPWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 77/227 (34%)
Tryp_SPc 30..258 CDD:238113 79/229 (34%)
si:dkey-21e2.16NP_001038273.1 Tryp_SPc 26..247 CDD:238113 79/229 (34%)
Tryp_SPc 26..244 CDD:214473 77/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.