DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Mcpt9

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_062196.2 Gene:Mcpt9 / 54272 RGDID:3068 Length:248 Species:Rattus norvegicus


Alignment Length:262 Identity:83/262 - (31%)
Similarity:124/262 - (47%) Gaps:22/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFV--VSLRRAKSGRHSCGATLLNPYWVLTAAH 72
            |.||:....|.....|  |:|:.||.:.|...|::  ::...:.|..:.||..|:....|:||||
  Rat     3 LFLFFLVAVLPVNTEG--GEILWGTESKPHSRPYMAFINFYDSNSDLNRCGGFLVAKDIVMTAAH 65

  Fly    73 CVRGSSPEQLDLQYGSQML-ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQ 136
            |    :...:.:..|:..: .|.::||..|.....|..:. .|..||||.||:|.:...|:..|:
  Rat    66 C----NGRNIKVILGAHNIKKRENTQVISVLKAKPHENFN-SDSLVNDIMLLKLERKAQLNGVVK 125

  Fly   137 PVRLPEPRQ-VTPGNASAVLAGWG--LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQIC 198
            .:.||..:. |.||....| ||||  .|.|   :...||:|.|:|....:|....:.|....|:|
  Rat   126 TIALPRSQDWVKPGQVCTV-AGWGTLANCT---LSNTLQEVNLEVQKGQKCQGMSRNYNDSIQLC 186

  Fly   199 AGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYS 263
            .|.|...|....||||||.:..|  ...||||:.:  |...| |.|||.:|:::.||.:|:....
  Rat   187 VGNPNERKATAGGDSGGPFVCNG--VAQGIVSYRL--CTWTP-PRVFTRISSFIPWIQKTMKLLQ 246

  Fly   264 PP 265
            .|
  Rat   247 QP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 73/231 (32%)
Tryp_SPc 30..258 CDD:238113 75/233 (32%)
Mcpt9NP_062196.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.