DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Mcpt4

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_062194.1 Gene:Mcpt4 / 54270 RGDID:3064 Length:246 Species:Rattus norvegicus


Alignment Length:255 Identity:82/255 - (32%)
Similarity:116/255 - (45%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRH--SCGATLLNPYWVLTAAHCV 74
            ||..|..|.:||..|:  |:.|..:.|...|::..|:......|  .||..|::..:||||||| 
  Rat     5 LFLMALLLPSGAGAEE--IIGGVESIPHSRPYMALLKIVTEEGHVTFCGGFLISLQFVLTAAHC- 66

  Fly    75 RGSSPEQLDLQYGS-QMLARNSSQ--VARVAAIFVHPGYEPEDKY-----VNDIALLQLAQSVAL 131
               ...::.:..|: .|..|.|:|  :..|..||       ..||     ..||.||:|.|...|
  Rat    67 ---HGREITVTLGAHDMSKRESTQQKIKVVKQIF-------PLKYNLFSNFRDIMLLKLEQKAVL 121

  Fly   132 SKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSE-RHQTYLHDS 195
            :..|..:.||:...:.......:.||||...........|::|.|::.....|.: ||  |.:..
  Rat   122 TPSVNVIPLPQSSDIIKPGTMCLAAGWGQTGVKEPNSNTLREVMLRIMEMKACKDYRH--YDNRF 184

  Fly   196 QICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            |||.|:|:..|....|||||||:..|  ...||||..  |....| |.:||.:|:||.||
  Rat   185 QICVGIPQMLKLAYKGDSGGPLVCAG--VAHGIVSHG--PGRGIP-PIIFTRISSYVSWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 73/236 (31%)
Tryp_SPc 30..258 CDD:238113 75/237 (32%)
Mcpt4NP_062194.1 Tryp_SPc 20..239 CDD:214473 73/238 (31%)
Tryp_SPc 21..242 CDD:238113 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.