DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Prss53

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:315 Identity:87/315 - (27%)
Similarity:133/315 - (42%) Gaps:75/315 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AWLARLALFYTATFLLAG------ASGEDG----KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGA 59
            :|...| |...|..::.|      |.|:.|    :...|.|. |||:|:..|:||  .|.|.|..
  Rat     4 SWGPEL-LIVGAVIVIEGLQAAQRACGQRGPGPPEPQEGNTL-PGEWPWQASVRR--QGVHICSG 64

  Fly    60 TLLNPYWVLTAAHCVRGSSPEQL---DLQYGS---QMLARNSSQVARVAAIFVHPGYEPEDKYVN 118
            :|:...||||||||....:..:|   .:..||   :.|:..:.:|. |||:.:...|....: .:
  Rat    65 SLVADTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGLSPGAEEVG-VAALQLPKAYNHYSQ-GS 127

  Fly   119 DIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNA---------------TGGV-- 166
            |:|||||...:..:...    ||:|....|..||....||..|.               ||.|  
  Rat   128 DLALLQLTHPIVHTTLC----LPQPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRESQTGSVLT 188

  Fly   167 --------------------VQQHLQKVKLQVFSDTEC----SERHQTYL----HDSQICAGLPE 203
                                |.:.|:.::|::.|...|    :..||..|    ....:|.|...
  Rat   189 VLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRLHQRLLANPARSGMLCGGAQP 253

  Fly   204 GGKGQCSGDSGGPLLLIGSD---TQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            |.:|.|.||||||::....|   .||||:|:: ..||:...|.:.|:::|:..|:
  Rat   254 GVQGPCQGDSGGPVMCREPDGHWVQVGIISFT-SNCAQEDTPVLLTDMAAHSSWL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 78/279 (28%)
Tryp_SPc 30..258 CDD:238113 79/280 (28%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 77/272 (28%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.