DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and deltaTry

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:237 Identity:79/237 - (33%)
Similarity:126/237 - (53%) Gaps:21/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQML 91
            ||:||.|:......||:.:||:|  ||.||||.::.:...::|||||::..|...|.::.||...
  Fly    28 DGRIVGGSATTISSFPWQISLQR--SGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYW 90

  Fly    92 ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGN-ASAVL 155
            : :......|::...|.||. .:..|||||::::..::..|..::.:.|...   .|.| |:|.:
  Fly    91 S-SGGVTFSVSSFKNHEGYN-ANTMVNDIAIIKINGALTFSSTIKAIGLASS---NPANGAAASV 150

  Fly   156 AGWG-LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQ-----ICAGLPEGGKGQCSGDSG 214
            :||| |:.....:...||.|.:.:.|.::|:.  .||.:.||     |||.  ..||..|.||||
  Fly   151 SGWGTLSYGSSSIPSQLQYVNVNIVSQSQCAS--STYGYGSQIRSTMICAA--ASGKDACQGDSG 211

  Fly   215 GPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIV 256
            ||  |:.....||:|||.. .||...:|||:.:|:|...|::
  Fly   212 GP--LVSGGVLVGVVSWGY-GCAYSNYPGVYADVAALRSWVI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 76/232 (33%)
Tryp_SPc 30..258 CDD:238113 77/234 (33%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 76/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.