DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and cela1.6

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:235 Identity:81/235 - (34%)
Similarity:120/235 - (51%) Gaps:10/235 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGR--HSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQML 91
            ::|.|..|.|..:|:.:||:....|.  |:||.||:...:||||||||..|...::.|.......
Zfish    29 RVVGGEVARPNSWPWQISLQYLSGGSYYHTCGGTLIKQNFVLTAAHCVDTSRTWRVVLGEHDIYK 93

  Fly    92 ARNSSQVARVAAIFVHPGYEPEDKYVN-DIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVL 155
            .....|...|:.:::||.:...:.... |||||:|:.:.:|:.:||...||...||.|.|.:..:
Zfish    94 QEGREQYMTVSNVYIHPNWNRNNVAAGYDIALLRLSSNASLNTYVQLGTLPPSGQVLPHNNACYI 158

  Fly   156 AGWGLNATGGVVQQHLQKVKLQVFSDTECS--ERHQTYLHDSQICAGLPEGGKGQCSGDSGGPL- 217
            .||||.:|||.:...|::..|.|.....||  :...:.:.::.:|||  .|....|.||||||| 
Zfish   159 TGWGLTSTGGSLSAQLKQAYLPVVDYNTCSRGDWWGSTVKNTMVCAG--GGSLSGCQGDSGGPLN 221

  Fly   218 -LLIGSDTQVGIVSW-SIKPCARPPFPGVFTEVSAYVDWI 255
             .:.|.....|:.|: |...|.....|.|||.||||:.||
Zfish   222 CQVSGQYVVHGVTSFVSSSGCNAYQKPTVFTRVSAYISWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 79/233 (34%)
Tryp_SPc 30..258 CDD:238113 81/234 (35%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 81/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.