DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG34130

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:269 Identity:56/269 - (20%)
Similarity:108/269 - (40%) Gaps:43/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NG--TTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRG--SSPEQLDLQYGSQMLA 92
            ||  .|:|....|::  ||........|||:.|:..:.||:|:|:..  |..|.|.::..|.. :
  Fly    44 NGIRRTSGGHAVPWL--LRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSD-S 105

  Fly    93 RNSSQV-------ARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGN 150
            |..:|:       |.:..|.|...:.....:: |:|:::|...:..::.........|.. :..:
  Fly   106 RQDNQLDSHDPPNALIRNIIVSKDWHWPGTFM-DVAVIELTNRLRGNRNNYVTLCTNPLS-SYKS 168

  Fly   151 ASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGG 215
            .|.|..|.|       ..::::..:::|.:...|...:..:|....:...........|...:|.
  Fly   169 LSVVSYGAG-------PAENVRTEEIEVLNRMICDSAYGNFLLRETVACAKEFKRSADCMFSAGC 226

  Fly   216 PLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVN--------------SYSPP- 265
            |  :...|...|||:|| ..|.|...||:||::.....:|::.::              |.:.| 
  Fly   227 P--VTAGDQLCGIVAWS-PACKRSNLPGIFTDIHQVKRFILKAISGKHKGTSHPKTERASDNVPE 288

  Fly   266 --SSLWVGQ 272
              |.||:.:
  Fly   289 WHSGLWLSR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 50/233 (21%)
Tryp_SPc 30..258 CDD:238113 51/236 (22%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 46/224 (21%)
Tryp_SPc 53..256 CDD:304450 46/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.