DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and intr

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:209 Identity:49/209 - (23%)
Similarity:80/209 - (38%) Gaps:44/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHC----VRGSSPEQLDLQYG 87
            ||:   .||..|......| :|.....:..|...|::...|||:|.|    :|...|....||  
  Fly    87 DGQ---ATTEAPKAVKHFV-MRILYENKVICSGALISTRLVLTSALCFPRTLRQPPPRSYKLQ-- 145

  Fly    88 SQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNAS 152
                 .:.|::..||.:....        :.|:||| |..:.....||.|:.|.|    :|...:
  Fly   146 -----ASRSRIYSVANLITGA--------IEDMALL-LLHAPLEDPFVHPIDLCE----SPLRRN 192

  Fly   153 AVLAGWGLNATGGVVQQHLQKVKLQVFSDTEC----SERHQTYLHDSQICAGLPEGGKGQCSGDS 213
            .       |.|..:.||||:.::.::..::.|    ::....::..:.:|| |.......|....
  Fly   193 D-------NVTMYMSQQHLRFLRTKLIPNSNCKRSYAQDENAFITQTMLCA-LNSNRLVDCQTAK 249

  Fly   214 GGPLL----LIGSD 223
            |..||    |.|.|
  Fly   250 GDVLLHQDRLCGVD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 47/207 (23%)
Tryp_SPc 30..258 CDD:238113 47/206 (23%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 42/180 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.