DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG34129

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:251 Identity:59/251 - (23%)
Similarity:104/251 - (41%) Gaps:59/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCV-------RGSSPEQLDLQY 86
            :|:||                  .|..:|||....|..|:|:|:|:       .|::.|      
  Fly    58 RILNG------------------DGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVE------ 98

  Fly    87 GSQMLARNSSQVARVAAI-----FVHPGYEPEDKYVNDIALLQLAQSV--ALSKFVQ--PVRLPE 142
            |:.....:....|.:..|     |::      .|...|:|:::|...|  .|::|::  .|::..
  Fly    99 GTAFSECDRENYADIDTIQFPEKFIY------QKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQP 157

  Fly   143 PRQVTPGNASAVLAGWGL-NATGGVVQQHLQKVKLQVFSDTECSERHQT-YLHDSQICAGLPEGG 205
            ..|:       |:.|||. |....:.....:.|.:.:.|..||.::.:: .:..:.|||..|:..
  Fly   158 KMQM-------VVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNP 215

  Fly   206 KGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS 261
            | ||..|.|.| |:.|.:. .|:||:. ..|.....||::|.:.....:|.||..|
  Fly   216 K-QCLYDGGSP-LIYGREL-CGVVSFG-SHCIDTSRPGMYTNIRRVKRFITETEES 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 55/243 (23%)
Tryp_SPc 30..258 CDD:238113 56/245 (23%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 55/243 (23%)
Tryp_SPc 55..261 CDD:304450 55/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.