DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG5246

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:242 Identity:73/242 - (30%)
Similarity:111/242 - (45%) Gaps:36/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQY------- 86
            :::.|..:..|..|:.||:... .|.|.||.:::.|.|:||||||:      :..:||       
  Fly    41 RVIGGVDSPTGFAPYQVSIMNT-FGEHVCGGSIIAPQWILTAAHCM------EWPIQYLKIVTGT 98

  Fly    87 ------GSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQ 145
                  |::.|...|.         :|..:: :..|.|||||:..|:.:......||::|.....
  Fly    99 VDYTRPGAEYLVDGSK---------IHCSHD-KPAYHNDIALIHTAKPIVYDDLTQPIKLASKGS 153

  Fly   146 VTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSE--RHQTYLHDSQICAGLPEGGKGQ 208
            :........|.|||...|.|.....|||:.|.......|..  |:..:|.:..:|....| |:|.
  Fly   154 LPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQE-GEGS 217

  Fly   209 CSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            |.|||||| |:..:.|.||:|:|. :.|| ..:|.||..|:.|.|||
  Fly   218 CHGDSGGP-LVDANQTLVGVVNWG-EACA-IGYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 71/240 (30%)
Tryp_SPc 30..258 CDD:238113 73/241 (30%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 71/240 (30%)
Tryp_SPc 42..263 CDD:238113 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.