DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG17477

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:263 Identity:90/263 - (34%)
Similarity:129/263 - (49%) Gaps:22/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LARLALFYTATF--LLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLT 69
            |||. |||...|  |.......:..||.|..|..|:.|:.||| :...|.|.||..:::..|::|
  Fly     3 LARF-LFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSL-QTLLGSHLCGGAIISDRWIIT 65

  Fly    70 AAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKF 134
            |.|||:|....:|.:..|:...|...: |....||::|..|: ..||.|||.||.|.:|:..:..
  Fly    66 AGHCVKGYPTSRLQVATGTIRYAEPGA-VYYPDAIYLHCNYD-SPKYQNDIGLLHLNESITFNAL 128

  Fly   135 VQPVRLPE---PRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTY----L 192
            .|.|.||.   ||    |.:..|..|||..:..|.:...||:|:.|..:...|......|    |
  Fly   129 TQAVELPTSPFPR----GASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLEL 189

  Fly   193 HDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVE 257
            ....||| ..:...|.|.|||||||:..|  |.|||:::.: |||: ..|.:|..:..|.||:.:
  Fly   190 GPCHICA-YRQANIGACHGDSGGPLVHQG--TLVGILNFFV-PCAQ-GVPDIFMNIMYYRDWMRQ 249

  Fly   258 TVN 260
            |::
  Fly   250 TMS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 80/232 (34%)
Tryp_SPc 30..258 CDD:238113 81/234 (35%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 81/234 (35%)
Tryp_SPc 27..246 CDD:214473 79/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.