DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG10405

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:232 Identity:84/232 - (36%)
Similarity:127/232 - (54%) Gaps:20/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRG--SSPEQLDLQYGSQ 89
            |.:||||..|..|:||:.:||||...  |.|||::|:..|.:|||||:.|  ..|.:..|:.|| 
  Fly    34 DSRIVNGREATEGQFPYQLSLRRQTV--HICGASILSSNWAITAAHCIDGHEQQPREFTLRQGS- 95

  Fly    90 MLARNSSQVARVAAIFVHPGYEPEDKYVN-DIALLQLAQ---SVALSKFVQPVRLPEPRQVTPGN 150
            ::..:...|..|.||:.||.|:..|  :| |:|||:.|.   |:.|.| |.|:|||...:....:
  Fly    96 IMRTSGGTVQPVKAIYKHPAYDRAD--MNFDVALLRTADGALSLPLGK-VAPIRLPTVGEAISES 157

  Fly   151 ASAVLAGWG-LNATGGVVQQHLQKVKLQVFSDTECSE--RHQTYLHDSQICAGLPEGGKGQCSGD 212
            ..||::||| ::.:..|:...|:...:...:..:|..  ||...:.::..||.  ......|.||
  Fly   158 MPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAA--ARNTDACQGD 220

  Fly   213 SGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVS 249
            ||||:...|  |.:|||||.: .||.|.:|||:|.::
  Fly   221 SGGPISAQG--TLIGIVSWGV-GCADPYYPGVYTRLA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 83/230 (36%)
Tryp_SPc 30..258 CDD:238113 83/229 (36%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 83/230 (36%)
Tryp_SPc 37..263 CDD:238113 83/229 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.