DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG17404

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:244 Identity:77/244 - (31%)
Similarity:124/244 - (50%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGE-FPFVVSLR-RAKSGR-HSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQM 90
            :||.|....||| .|:.|||: |.:.|: |.||.:::.|..:||||||.:|.:..::.:..|.:.
  Fly    34 RIVGGADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGLNASRMSVVAGIRG 98

  Fly    91 LARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVAL-SKFVQPVRL-PEPRQVTPGNASA 153
            |....|: ::|.:..:||.|  ::...:|:|:|.:...:.| :..:..:.. .:.:....|....
  Fly    99 LNEKGSR-SQVLSYSIHPKY--QELVTSDLAVLSIKPPLKLNNSTISAIEYRSQGKDFVGGGVPV 160

  Fly   154 VLAGWGL----------NATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQ 208
            .|.||||          |.....|   ||::.....|::||.......:.|::|||..|  .:|.
  Fly   161 TLTGWGLRLPVPFPFLDNVNYPNV---LQRMSYHTISNSECRNAGMESVTDTEICARGP--FRGA 220

  Fly   209 CSGDSGGPLLLIGSD--TQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            |||||||||::...:  .||||||:.:..|.....|.|:|.||.:.|||
  Fly   221 CSGDSGGPLVMESKNGLQQVGIVSYGLVVCGLYISPDVYTRVSTFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 75/242 (31%)
Tryp_SPc 30..258 CDD:238113 77/243 (32%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 75/242 (31%)
Tryp_SPc 35..269 CDD:238113 75/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.