DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG16749

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:258 Identity:121/258 - (46%)
Similarity:156/258 - (60%) Gaps:18/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LARLALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAA 71
            ||..||..||.  ::..:.:.|::||||.:...::|||:|: |..||.||||.::::..:|:|||
  Fly     9 LAVFALLTTAG--ISHGAPQMGRVVNGTDSSVEKYPFVISM-RGSSGSHSCGGSIISKQFVMTAA 70

  Fly    72 HCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKF-V 135
            ||..|.....|.:|||...:......|.||..|..|..|.|.:.|.|||:||.:.:....... |
  Fly    71 HCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTV 135

  Fly   136 QPVRLPEPRQVTP---GNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERH-----QTYL 192
            .||:|||....||   .....||.|||||||||.:|..||:|:|:|:||.||:|||     ..| 
  Fly   136 APVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRY- 199

  Fly   193 HDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
               .||.|:.|||||||||||||||:..|.  ||||||||||||...|:|||:.:||.|||||
  Fly   200 ---HICGGVDEGGKGQCSGDSGGPLIYNGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 112/234 (48%)
Tryp_SPc 30..258 CDD:238113 114/235 (49%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 112/234 (48%)
Tryp_SPc 30..259 CDD:238113 114/235 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0U
Homologene 1 1.000 - - H89214
Inparanoid 1 1.050 228 1.000 Inparanoid score I5860
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27286
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 1 1.000 - - FOG0012685
OrthoInspector 1 1.000 - - otm42512
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
109.980

Return to query results.
Submit another query.