DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG12951

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:236 Identity:107/236 - (45%)
Similarity:142/236 - (60%) Gaps:16/236 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR 93
            ::||||.:...::|||||| |:..|.||||.::::.::|:|||||..|...:.|.:|:|...::.
  Fly    29 RVVNGTDSSVLKYPFVVSL-RSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISA 92

  Fly    94 NSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKF-VQPVRLPEPRQVTP---GNASAV 154
            ....|..:..|..|..::|..:..|||:||.:.:....... |.||.||......|   .....|
  Fly    93 MGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGV 157

  Fly   155 LAGWGLNATGGVVQQHLQKVKLQVFSDTECSERH--QT---YLHDSQICAGLPEGGKGQCSGDSG 214
            |.|||||.|.|.||..||:|.|:::||.||:.||  ||   |    .||.|:.||||||||||||
  Fly   158 LIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKY----HICGGVDEGGKGQCSGDSG 218

  Fly   215 GPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            |||:..|.  ||||||||||||...|:|||:.:||.|||||
  Fly   219 GPLIYNGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 105/234 (45%)
Tryp_SPc 30..258 CDD:238113 107/235 (46%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 105/234 (45%)
Tryp_SPc 30..260 CDD:238113 107/235 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0U
Homologene 1 1.000 - - H89214
Inparanoid 1 1.050 228 1.000 Inparanoid score I5860
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27286
OrthoDB 1 1.010 - - D61497at7147
OrthoFinder 1 1.000 - - FOG0012685
OrthoInspector 1 1.000 - - otm42512
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
109.980

Return to query results.
Submit another query.