DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:235 Identity:83/235 - (35%)
Similarity:129/235 - (54%) Gaps:16/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHC-VRGSSPEQLDLQYGSQMLA 92
            |:..|..|..||:|:..||:  ::..|.|||||::..|::||||| ||.::|:...:.:|. :|:
  Rat   186 KVAGGQDAEEGEWPWQASLQ--QNNVHRCGATLISNSWLITAAHCFVRSANPKDWKVSFGF-LLS 247

  Fly    93 RNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAG 157
            :..:|.| |.:|.:|..|. ...:.||||:::|:..|.....::...|||..|..|.|:..|:.|
  Rat   248 KPQAQRA-VKSIVIHENYS-YPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVVVTG 310

  Fly   158 WGLNATGGVVQQHLQKVKLQVFSDTECS--ERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLI 220
            ||...:.|.....|||.::::..:..|:  :.:...:....:|||..||....|.||||||  |:
  Rat   311 WGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGRVDACQGDSGGP--LV 373

  Fly   221 GSDTQ-----VGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            ..|::     .|||||. ..||.|..|||:|.|:.|.|||
  Rat   374 SEDSKGIWFLAGIVSWG-DECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 81/233 (35%)
Tryp_SPc 30..258 CDD:238113 82/234 (35%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 81/233 (35%)
Tryp_SPc 187..415 CDD:238113 82/234 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.