DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Tryx5

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006236430.1 Gene:Tryx5 / 408205 RGDID:1302947 Length:251 Species:Rattus norvegicus


Alignment Length:248 Identity:61/248 - (24%)
Similarity:99/248 - (39%) Gaps:52/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PGEF--PFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVAR 100
            |..|  |::..|   ||....|..||::|.||||||||   |.|.::.|......:.....|:..
  Rat    33 PENFNVPYMAYL---KSSPEPCVGTLIDPLWVLTAAHC---SLPTKIRLGVYRPNIKNEKEQIHG 91

  Fly   101 VAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLP-EPRQVTPGNASAVLAGWGLNATG 164
            .:...|||.::...: .||:.|::|:....:..:|..:.:. ||...   |.:..:..|..|   
  Rat    92 YSLTVVHPNFDANIR-KNDLMLIKLSYPATIDMYVGTIAIAMEPMVF---NETCFIPTWTWN--- 149

  Fly   165 GVVQQHLQKVKLQVFSD--------------TEC-----SERHQTYLHDSQICAGLPEGGKGQCS 210
                 |...     :||              ::|     .:|.:|.:  :.:|.|.....|....
  Rat   150 -----HYNN-----YSDPDTLTWTNQYSRSPSDCWNTLHQQRQETRI--NIMCIGHSFNVKSSTK 202

  Fly   211 GDSGGPLLLIGSDTQV-GIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSY 262
            ..|..|.:..|   :| ||:||. |........|.|||:..|..||:..::|:
  Rat   203 EVSAAPAICSG---RVHGILSWG-KAGITNGSEGFFTEIHPYARWILRVMHSH 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 58/239 (24%)
Tryp_SPc 30..258 CDD:238113 60/242 (25%)
Tryx5XP_006236430.1 Tryp_SPc 37..244 CDD:419748 56/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.