DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and prss29

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:247 Identity:91/247 - (36%)
Similarity:122/247 - (49%) Gaps:18/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR 93
            :||.||.:..||:|:.:||.  ..|...||.:||...||||||||....:..:.....|...|:.
 Frog    25 RIVGGTDSEEGEWPWQISLE--FEGGFLCGGSLLTDSWVLTAAHCFDSMNVSKYTAYLGVYQLSD 87

  Fly    94 NSSQVAR-VAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAG 157
            ..:.|.| |..|.|||.|..|.. ..||||::|.:.:..:..:|||.||......|......:.|
 Frog    88 LDNAVLRGVKNITVHPDYMYEGS-SGDIALIELEEPIVFTPSIQPVCLPSQDVPLPMGTMCWVTG 151

  Fly   158 WGLNATGGVVQ--QHLQKVKLQVFSDTECSERHQTYL---------HDSQICAGLPEGGKGQCSG 211
            ||.......::  |.|||.::.:.:.|.|...:|:.|         .|..||||..:|....|.|
 Frog   152 WGNIKENTPLEDPQTLQKAEVGLINRTSCEAMYQSSLGYRPSIHLIQDDMICAGYKQGKIDACQG 216

  Fly   212 DSGGPLLLIGSDT--QVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS 261
            ||||||:...|:|  |.|||||.: .||.|..|||:|.|..|:.||.|.|.|
 Frog   217 DSGGPLVCNTSNTWLQFGIVSWGL-GCAEPNQPGVYTNVQYYLTWIQELVPS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 86/239 (36%)
Tryp_SPc 30..258 CDD:238113 88/241 (37%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 88/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.