DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG10587

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:256 Identity:79/256 - (30%)
Similarity:119/256 - (46%) Gaps:40/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GEDGKIVNG---TTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRG--SSPEQLDL 84
            |...::|.|   |.|..|  .::::||...:  ..||.|||:...|||||||..|  ...:.|.:
  Fly    41 GFQTRVVGGDVTTNAQLG--GYLIALRYEMN--FVCGGTLLHDLIVLTAAHCFLGRVKISDWLAV 101

  Fly    85 QYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPG 149
            ...|::   |...:.|.....:......||....|:|:|:|.:.:......|.:..  .:|:.||
  Fly   102 GGASKL---NDRGIQRQVKEVIKSAEFREDDMNMDVAILRLKKPMKGKSLGQLILC--KKQLMPG 161

  Fly   150 NASAVLAGWGL--NATGGVVQQHLQKVKLQVFSDTEC----------SERH-----QTYLHDSQI 197
            ....| :||||  |:..| .|:.|:.|.:.|....:|          |.:|     :.:|.||..
  Fly   162 TELRV-SGWGLTENSEFG-PQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMF 224

  Fly   198 CAGLPEGGKGQCSGDSGGPLLLIGSDTQV-GIVSWSIKPCARPPFPGVFTEVSAYVDWIVE 257
            |||: .|.|..|:.||||||:.   ..|| ||||:.| .||...:.||:|:: .||...:|
  Fly   225 CAGV-LGKKDACTFDSGGPLVY---KNQVCGIVSFGI-GCASKRYYGVYTDI-MYVKPFIE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 77/248 (31%)
Tryp_SPc 30..258 CDD:238113 78/251 (31%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 77/249 (31%)
Tryp_SPc 46..280 CDD:238113 78/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.