DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG11037

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:260 Identity:81/260 - (31%)
Similarity:118/260 - (45%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAWLARLAL-FYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWV 67
            :|.||::.| ....|.::.|....:.|:....||...|..||            ||.||||...|
  Fly    46 VAQLAKIVLPSPHETRVIGGHVTTNAKLGGYLTALLYEDDFV------------CGGTLLNENIV 98

  Fly    68 LTAAHCVRG-SSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVAL 131
            ||||||..| ....:..:..|...|  |...:.|....|:......||....|:|:: |.::...
  Fly    99 LTAAHCFLGRMKASEWIVAAGISNL--NQKGIRRHVKDFILSEQFREDDMNMDVAVV-LLKTPLK 160

  Fly   132 SKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQH-LQKVKLQVFSDTECSERHQ--TYLH 193
            :|.:..:.|... .:.|| ...|::|||:.|..|....: |:.|.:.:.....|...:|  ..:.
  Fly   161 AKNIGTLSLCSV-SLKPG-VELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKIT 223

  Fly   194 DSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQV-GIVSWSIKPCARPPFPGVFTEVSAYVDWIVE 257
            ||.|||.: .|.|..|:.||||||:.   ..|| ||||:.| .||...:|||:|:| .||...:|
  Fly   224 DSMICAAV-LGRKDACTFDSGGPLVF---KKQVCGIVSFGI-GCASNRYPGVYTDV-MYVKPFIE 282

  Fly   258  257
              Fly   283  282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/230 (32%)
Tryp_SPc 30..258 CDD:238113 74/233 (32%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 75/242 (31%)
Tryp_SPc 62..283 CDD:238113 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.