DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Sems

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:242 Identity:70/242 - (28%)
Similarity:111/242 - (45%) Gaps:27/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRG-SSPEQLDLQYGSQML 91
            |::......|    .::|::|...:  ..||.||::...|||||||... :..|...:..|...|
  Fly    47 GRVTTNAKLG----GYLVAMRYFNN--FICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRL 105

  Fly    92 ARNSSQVARVAAIFVHPGYEPEDKYVN---DIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASA 153
            :...  :.|....|:.   ..:.|.|.   |:|::.|.:.: :.|.:..:.|.. ..:|||....
  Fly   106 SEKG--IRRQVKRFIK---SAQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCS-TALTPGQTMD 163

  Fly   154 VLAGWGLNATGGVVQQH-LQKVKLQVFSDTECSE--RHQTYLHDSQICAGLPEGGKGQCSGDSGG 215
            | :|||:.........| |:.|.:.|.....|.|  |....:.||..||.: .|.|..|:.||||
  Fly   164 V-SGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASV-LGKKDACTYDSGG 226

  Fly   216 PLLLIGSDTQV-GIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS 261
            ||:.   :.|| ||||:.| .||...:|||:|:|.....:||:.:.:
  Fly   227 PLVY---EKQVCGIVSFGI-GCASRRYPGVYTDVHYVKPFIVKGIKA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 67/233 (29%)
Tryp_SPc 30..258 CDD:238113 69/235 (29%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 68/234 (29%)
Tryp_SPc 44..265 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.