DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and PRSS57

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_999875.2 Gene:PRSS57 / 400668 HGNCID:31397 Length:283 Species:Homo sapiens


Alignment Length:278 Identity:89/278 - (32%)
Similarity:130/278 - (46%) Gaps:27/278 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVMAWLARLALFYTATFL----LAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATL 61
            :.:..|...|....||..|    .||:.|  .:|:.|....|...|::.|:|  ..|:|.||..|
Human     3 LGLRGWGRPLLTVATALMLPVKPPAGSWG--AQIIGGHEVTPHSRPYMASVR--FGGQHHCGGFL 63

  Fly    62 LNPYWVLTAAHCVRGSSPEQLDLQYGSQML-------ARNSSQVARVAAIFVHPGYEPEDKYVND 119
            |...||::||||.     ...||:.|..:|       |..:.||..:.|:..||.|.|. .:.||
Human    64 LRARWVVSAAHCF-----SHRDLRTGLVVLGAHVLSTAEPTQQVFGIDALTTHPDYHPM-THAND 122

  Fly   120 IALLQLAQSVALSKFVQPVRLPEPRQVTPGNAS--AVLAGWGLNATGGVVQQHLQKVKLQVFSDT 182
            |.||:|..|..|...|..:| |..|:..|..|.  ..:||||..:....:...|.:.|::|....
Human   123 ICLLRLNGSAVLGPAVGLLR-PPGRRARPPTAGTRCRVAGWGFVSDFEELPPGLMEAKVRVLDPD 186

  Fly   183 ECSERHQTYLHDSQICAGLPEG-GKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFT 246
            .|:...:.:|..:.:|....:. .:|.||.|||||  |:..:...|:||:|...|..|..|.|:|
Human   187 VCNSSWKGHLTLTMLCTRSGDSHRRGFCSADSGGP--LVCRNRAHGLVSFSGLWCGDPKTPDVYT 249

  Fly   247 EVSAYVDWIVETVNSYSP 264
            :|||:|.||.:.|...||
Human   250 QVSAFVAWIWDVVRRSSP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 76/235 (32%)
Tryp_SPc 30..258 CDD:238113 78/237 (33%)
PRSS57NP_999875.2 Tryp_SPc 34..258 CDD:238113 76/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.