DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG4477

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:258 Identity:65/258 - (25%)
Similarity:105/258 - (40%) Gaps:56/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FVVSLRRAKSGR-----HSCGATLLNPYWVLTAAHCVRGS-----SPEQLDLQYGSQMLAR---- 93
            :.||||...:.:     |.|...:|.|.:|:|:|||:...     |...|.:..|:  |.|    
  Fly    53 YCVSLRSRSAEKFFGDNHFCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGT--LNRLKYI 115

  Fly    94 -NSSQVARVAAIFVHPGYEPEDKYVNDIALLQLA-------QSVALSKFVQPVRLPEPRQVTPGN 150
             |.:.|..|..|::...:...:|  .|..||::.       :.:::::.  ||..|     .||.
  Fly   116 PNRTFVTPVTHIWLPDSFTMRNK--QDFGLLKVKNPFPRNNEHISIARL--PVHPP-----LPGL 171

  Fly   151 ASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTEC-------SERHQTYLHDSQICAGLPEGGKGQ 208
            ...|: |||....||.:..::..:.:||.....|       |..|...:....:.|..|      
  Fly   172 KCKVM-GWGRMYKGGPLASYMLYIDVQVIDSEACAKWLRVPSVEHVCAVDSDDLTAQQP------ 229

  Fly   209 CSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYS------PP 265
            |.||.|.|:|..|  |..|||: .:..|.....|.::|.|.:..:||.|.:.|.:      ||
  Fly   230 CGGDWGAPMLHNG--TVYGIVT-ILAGCGVSHLPSLYTNVHSNANWIHEKIISSAGSILLVPP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 59/240 (25%)
Tryp_SPc 30..258 CDD:238113 61/243 (25%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 61/241 (25%)
Tryp_SPc 55..273 CDD:214473 59/238 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.