DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG32374

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:239 Identity:76/239 - (31%)
Similarity:113/239 - (47%) Gaps:17/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR 93
            :||||........|:..:|.  .:....||..:||..|:|||.||..| :|.:..::.||.. .|
  Fly    73 RIVNGKKIKCSRAPYQCALH--YNNYFICGCVILNRRWILTAQHCKIG-NPGRYTVRAGSTQ-QR 133

  Fly    94 NSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLA-G 157
            ...|:..|.....||.|. |....||:.:::|...:.:.:.||.|:||..|  |.......|| |
  Fly   134 RGGQLRHVQKTVCHPNYS-EYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTR--TKRFPKCYLASG 195

  Fly   158 WGL-NATGGVVQQHLQKVKLQVFSDTECSERHQ---TYLHDSQICAGLPEGGKGQCSGDSGGPLL 218
            ||| :|....||::|:.|.:...|..:|.:.::   ..::...|||  ....:..||||||||  
  Fly   196 WGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA--KRKNRDTCSGDSGGP-- 256

  Fly   219 LIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSY 262
            |:.:....||.|:.| .||...:|||:..|..|..||.:....|
  Fly   257 LVHNGVLYGITSFGI-GCASAKYPGVYVNVLQYTRWIKKVAKKY 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 73/230 (32%)
Tryp_SPc 30..258 CDD:238113 75/232 (32%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 73/230 (32%)
Tryp_SPc 74..295 CDD:238113 75/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.