DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and KLK2

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_005542.1 Gene:KLK2 / 3817 HGNCID:6363 Length:261 Species:Homo sapiens


Alignment Length:258 Identity:84/258 - (32%)
Similarity:126/258 - (48%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLAGASGE----DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSP 79
            |..|.:|.    ..:||.|........|:.|::  ...|...||..|::|.||||||||::.:| 
Human    10 LSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAV--YSHGWAHCGGVLVHPQWVLTAAHCLKKNS- 71

  Fly    80 EQLDLQYGSQMLARNSSQVARVAAIFVHPGY----------EPEDKYVNDIALLQLAQSVALSKF 134
             |:.|...:.....::.|...|:..|.||.|          .|::...:|:.||:|::...::..
Human    72 -QVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDV 135

  Fly   135 VQPVRLP--EPRQVTPGNASAVLAGWG-LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQ 196
            |:.:.||  ||...|...||    ||| :.....:..:.||.|.|.:.|:..|:..:...:.:..
Human   136 VKVLGLPTQEPALGTTCYAS----GWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFM 196

  Fly   197 ICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETV 259
            :||||..|||..|.|||||||:..|  ...||.||..:|||.|..|.|:|:|..|..||.:|:
Human   197 LCAGLWTGGKDTCGGDSGGPLVCNG--VLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 78/238 (33%)
Tryp_SPc 30..258 CDD:238113 80/240 (33%)
KLK2NP_005542.1 Tryp_SPc 25..256 CDD:238113 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.