DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and KLK1

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:272 Identity:84/272 - (30%)
Similarity:123/272 - (45%) Gaps:33/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WLARLALFYTATFLLAGASGE----DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYW 66
            |...|.|     .|..|.:|.    ..:||.|........|:..:|....:  ..||..|::..|
Human     2 WFLVLCL-----ALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFST--FQCGGILVHRQW 59

  Fly    67 VLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGY----------EPEDKYVNDIA 121
            |||||||:  |...||.|...:.....|::|...|:..|.|||:          :.::.|.:|:.
Human    60 VLTAAHCI--SDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLM 122

  Fly   122 LLQLAQSV-ALSKFVQPVRLP--EPRQVTPGNASAVLAGWG-LNATGGVVQQHLQKVKLQVFSDT 182
            ||:|.:.. .::..|:.|.||  ||..    .::.:.:||| :..........||.|.|::..:.
Human   123 LLRLTEPADTITDAVKVVELPTEEPEV----GSTCLASGWGSIEPENFSFPDDLQCVDLKILPND 183

  Fly   183 ECSERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTE 247
            ||.:.|...:.|..:|.|..||||..|.|||||||:..|  ...|:.||...||..|..|.|...
Human   184 ECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDG--VLQGVTSWGYVPCGTPNKPSVAVR 246

  Fly   248 VSAYVDWIVETV 259
            |.:||.||.:|:
Human   247 VLSYVKWIEDTI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 75/239 (31%)
Tryp_SPc 30..258 CDD:238113 77/241 (32%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.