DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG32270

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:242 Identity:83/242 - (34%)
Similarity:126/242 - (52%) Gaps:21/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLA- 92
            :||.|..:.....|.:|::||  .|...||.:|:.|..|||||||:...:|....::.|...|: 
  Fly    30 RIVGGHPSDVWHQPHMVNIRR--RGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSD 92

  Fly    93 -RNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLP--EPRQVTPGNASAV 154
             |||..|.::    :.|.........:|:|||||.|.:..| ..:|:.|.  .||   ||:...|
  Fly    93 MRNSRYVRKI----LMPSAYSRTTLDHDVALLQLKQPLQAS-IAKPISLAVRSPR---PGSFVRV 149

  Fly   155 LAGWGL-NATGGVVQQHLQKVKLQVFSDTECSERHQTY--LHDSQICAGLPEGGKGQCSGDSGGP 216
             :|||| :::...:...||.|.:||....||.:.::.|  :..|..||.:| |.|..|:||||||
  Fly   150 -SGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVP-GLKDACAGDSGGP 212

  Fly   217 LLLIGSDTQVGIVSWS-IKPCARPPFPGVFTEVSAYVDWIVETVNSY 262
             ::..:...||:|||. ...||....|||:::||...|||.:.::.|
  Fly   213 -VVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNIHRY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 80/233 (34%)
Tryp_SPc 30..258 CDD:238113 82/235 (35%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 80/233 (34%)
Tryp_SPc 31..254 CDD:238113 82/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.