DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG9897

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:257 Identity:63/257 - (24%)
Similarity:117/257 - (45%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQML 91
            |.:|:||.|....:.|:..|:  ..:.:..||..:::..::||||.||.|.|...:.::.|:...
  Fly    20 DQRIINGNTVNIKDAPWYASI--IVNSKLKCGGAIISKNYILTAAKCVDGYSARSIQVRLGTSSC 82

  Fly    92 ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLA 156
            . .|..:|.:..:.||..|. ..::.|::|||:..:.:..:..::|:...:  :|...|:.|.:.
  Fly    83 G-TSGSIAGICKVKVHSQYS-SWRFDNNLALLKTCELLNTTDEIKPIERAD--KVPDDNSRANVT 143

  Fly   157 GWG------------LNATGGVVQQ------HLQKVKLQVFSDTECSERHQT---YL----HDSQ 196
            |.|            |..:.|:.::      .|...::::.|..:|:...:.   ||    .|..
  Fly   144 GCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADWKVIPFYLLKGISDLT 208

  Fly   197 ICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVS---WSIKPCARPPFPGVFTEVSAYVDWI 255
            ||...|  |||.||.|.|.||::  .:..|||:|   .|||       |.|:..:..:.:|:
  Fly   209 ICTKSP--GKGACSTDRGSPLVI--DNKLVGILSRAGCSIK-------PDVYANILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 61/253 (24%)
Tryp_SPc 30..258 CDD:238113 62/254 (24%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 61/252 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.