DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and etaTry

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:257 Identity:86/257 - (33%)
Similarity:125/257 - (48%) Gaps:20/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLL---AGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHS----CGATLLNPYWVLTAAHCVR 75
            |||   |.::..||:||.|.........:||.|||..|...|    ||..:|:...:.||||||.
  Fly    13 FLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVY 77

  Fly    76 GSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKF--VQPV 138
            ....|...:..|.......:..|.||:.:..|..|. .....|||||:.:...:.|..|  ::.:
  Fly    78 NREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYN-SSTMDNDIALVVVDPPLPLDSFSTMEAI 141

  Fly   139 RLPEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTY---LHDSQICAG 200
            .:...:...  ...|.::|||.....|:....||:||:.:....:|.|.:  |   :.:..:|||
  Fly   142 EIASEQPAV--GVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAY--YWRPISEGMLCAG 202

  Fly   201 LPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSY 262
            |.||||..|.|||||||::  ::...|||||. :.||||.:|||:..|:.|.|||.:...||
  Fly   203 LSEGGKDACQGDSGGPLVV--ANKLAGIVSWG-EGCARPNYPGVYANVAYYKDWIAKQRTSY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 76/234 (32%)
Tryp_SPc 30..258 CDD:238113 78/236 (33%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 76/234 (32%)
Tryp_SPc 28..257 CDD:238113 78/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.