DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and PRSS41

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:274 Identity:88/274 - (32%)
Similarity:136/274 - (49%) Gaps:30/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLAGASGE---DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCV-RGSSP 79
            ||:.|.|.   ...:..|..:..|.:|:..|||..:  ||.||.:||:..|||:||||. :...|
Human    57 LLSEACGHREIHALVAGGVESARGRWPWQASLRLRR--RHRCGGSLLSRRWVLSAAHCFQKHYYP 119

  Fly    80 EQLDLQYGSQMLARNS-------SQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQP 137
            .:..:|.| ::.:|.:       |...:|..|.|:|  :......||||||:||.||..:.::||
Human   120 SEWTVQLG-ELTSRPTPWNLRAYSSRYKVQDIIVNP--DALGVLRNDIALLRLASSVTYNAYIQP 181

  Fly   138 VRLPEPRQVTPGNASAVLAGWGLNATGGV---VQQHLQKVKLQVFSDTECS-----ERHQTYLHD 194
            :.:..............:.||||.:..|.   ...:|::.::.:.::|.|:     ...::.:.|
Human   182 ICIESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSRSMIWD 246

  Fly   195 SQICAGLPEGGKGQCSGDSGGPLLL--IGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVE 257
            |..|||..:|....|.|||||||:.  .|...|||||||.: .|.:|..|||:|.:|.|..||..
Human   247 SMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGM-DCGQPNRPGVYTNISVYFHWIRR 310

  Fly   258 TVNSYSP---PSSL 268
            .::..:|   ||.|
Human   311 VMSHSTPRPNPSQL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 78/243 (32%)
Tryp_SPc 30..258 CDD:238113 80/245 (33%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.